Plant Transcription Factor Database
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PGSC0003DMP400007972
Common NameLOC102582060
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum
Family BES1
Protein Properties Length: 320aa    MW: 34481.9 Da    PI: 9.0808
Description BES1 family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PGSC0003DMP400007972genomePGSCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
                DUF822   1 ggsgrkptwkErEnnkrRERrRRaiaakiyaGLRaqGnyklpkraDnneVlkALcreAGwvvedDGttyrkgskpleeaeaagssasas 89 
                           g+sgr ptwkErEnnkrRERrRRaiaaki++GLR qGn+klpk++DnneVlkALc eAGw+vedDGttyrkg+ p+   e + +s ++s
                           689*************************************************************************.9999******** PP

                DUF822  90 pesslqsslkssalaspvesysaspksssfpspssldsislasaasllpvlsvlslvsss 149
                            +ss+q s+ ss+++spv+sy+asp+sssfpsps+ d ++++    +lp+l++l++++s+
                           ***************************************985...999***999998876 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF056872.4E-6110134IPR008540BES1/BZR1 plant transcription factor, N-terminal
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009741Biological Processresponse to brassinosteroid
GO:0005634Cellular Componentnucleus
GO:0005737Cellular Componentcytoplasm
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 320 aa     Download sequence    Send to blast
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0135920.0BT013592.1 Lycopersicon esculentum clone 132355R, mRNA sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006346930.10.0PREDICTED: BES1/BZR1 homolog protein 2-like
SwissprotQ94A431e-104BEH2_ARATH; BES1/BZR1 homolog protein 2
TrEMBLM0ZZL50.0M0ZZL5_SOLTU; Uncharacterized protein
STRINGPGSC0003DMT4000114700.0(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G19350.33e-82BES1 family protein
Publications ? help Back to Top
  1. Xu X, et al.
    Genome sequence and analysis of the tuber crop potato.
    Nature, 2011. 475(7355): p. 189-95